Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Lamprey globin [46518] (2 species) |
Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries) |
Domain d3lhbj_: 3lhb J: [15613] complexed with hem |
PDB Entry: 3lhb (more details), 2.7 Å
SCOPe Domain Sequences for d3lhbj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lhbj_ a.1.1.2 (J:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla aviadtvaagdagfeklmsmicillrsay
Timeline for d3lhbj_: