Lineage for d3c9fa1 (3c9f A:338-561)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871311Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425
  4. 871312Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (1 family) (S)
  5. 871313Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 871314Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species)
  7. 871315Species Candida albicans [TaxId:5476] [160693] (1 PDB entry)
    Uniprot Q5A5Q7 338-561
  8. 871316Domain d3c9fa1: 3c9f A:338-561 [156125]
    Other proteins in same PDB: d3c9fa2, d3c9fb2
    complexed with fmt, na, zn; mutant

Details for d3c9fa1

PDB Entry: 3c9f (more details), 1.9 Å

PDB Description: crystal structure of 5'-nucleotidase from candida albicans sc5314
PDB Compounds: (A:) 5'-nucleotidase

SCOP Domain Sequences for d3c9fa1:

Sequence, based on SEQRES records: (download)

>d3c9fa1 d.114.1.1 (A:338-561) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Candida albicans [TaxId: 5476]}
dtligyvktnyyvdyvpidhpksifnllalkilktlpkskheeritiintgsirydlykg
pytidskfivspfeniwvnitvpksvatkvaaklndadyisasrlkpphqydlqvqdlst
sphqahfemqeklpkgyvthddfgadgddtlhravvnfpvpnviqsveindevdspvnlv
fysfitpniiwalkelnfsteqvptpysdiylgtllnefvanne

Sequence, based on observed residues (ATOM records): (download)

>d3c9fa1 d.114.1.1 (A:338-561) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Candida albicans [TaxId: 5476]}
dtligyvktnyyvdyvpidhpksifnllalkilktlpkskheeritiintgsirydlykg
pytidskfivspfeniwvnitvpksvatkvaaklndyisasrlkpphqydlqvqqeklpk
gyvthddfgadgddtlhravvnfpvpnviqsveindevdspvnlvfysfitpniiwalke
lnfsteqvptpysdiylgtllnefvanne

SCOP Domain Coordinates for d3c9fa1:

Click to download the PDB-style file with coordinates for d3c9fa1.
(The format of our PDB-style files is described here.)

Timeline for d3c9fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c9fa2