Lineage for d3c96a2 (3c96 A:183-293)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 854987Family d.16.1.2: PHBH-like [54378] (4 proteins)
  6. 854993Protein Monooxygenase PhzS [159948] (1 species)
  7. 854994Species Pseudomonas aeruginosa [TaxId:287] [159949] (1 PDB entry)
    Uniprot Q9HWG9 183-293
  8. 854995Domain d3c96a2: 3c96 A:183-293 [156123]
    Other proteins in same PDB: d3c96a1
    complexed with fad

Details for d3c96a2

PDB Entry: 3c96 (more details), 1.9 Å

PDB Description: crystal structure of the flavin-containing monooxygenase phzs from pseudomonas aeruginosa. northeast structural genomics consortium target par240
PDB Compounds: (A:) Flavin-containing monooxygenase

SCOP Domain Sequences for d3c96a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c96a2 d.16.1.2 (A:183-293) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}
shggitmwrgvtefdrfldgktmivandehwsrlvaypisarhaaegkslvnwvcmvpsa
avgqldneadwnrdgrledvlpffadwdlgwfdirdlltrnqlilqypmvd

SCOP Domain Coordinates for d3c96a2:

Click to download the PDB-style file with coordinates for d3c96a2.
(The format of our PDB-style files is described here.)

Timeline for d3c96a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c96a1