Lineage for d3c96a1 (3c96 A:4-182,A:294-402)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096713Protein Monooxygenase PhzS [159434] (1 species)
  7. 2096714Species Pseudomonas aeruginosa [TaxId:287] [159435] (1 PDB entry)
    Uniprot Q9HWG9 4-182,294-402
  8. 2096715Domain d3c96a1: 3c96 A:4-182,A:294-402 [156122]
    Other proteins in same PDB: d3c96a2, d3c96a3
    complexed with fad

Details for d3c96a1

PDB Entry: 3c96 (more details), 1.9 Å

PDB Description: crystal structure of the flavin-containing monooxygenase phzs from pseudomonas aeruginosa. northeast structural genomics consortium target par240
PDB Compounds: (A:) Flavin-containing monooxygenase

SCOPe Domain Sequences for d3c96a1:

Sequence, based on SEQRES records: (download)

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}
pidiliagagigglscalalhqagigkvtllessseirplgvginiqpaavealaelglg
palaataipthelryidqsgatvwseprgveagnaypqysihrgelqmillaavrerlgq
qavrtglgverieerdgrvligardghgkpqalgadvlvgadgihsavrahlhpdqrplX
rdplphwgrgritllgdaahlmypmgangasqaildgielaaalarnadvaaalreyeea
rrptankiilanrerekeewaaasrpkteksaaleaitgsyrnqverpr

Sequence, based on observed residues (ATOM records): (download)

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}
pidiliagagigglscalalhqagigkvtllessseirplgvginiqpaavealaelglg
palaataipthelryidqsgatvwseprgveagnaypqysihrgelqmillaavrerlgq
qavrtglgverieerdgrvligardghgkpqalgadvlvgadgihsavrahlhpdqrplX
rdplphwgrgritllgdaahlmypmgangasqaildgielaaalarnadvaaalreyeea
rrptankiilanrerekeewaaasrperpr

SCOPe Domain Coordinates for d3c96a1:

Click to download the PDB-style file with coordinates for d3c96a1.
(The format of our PDB-style files is described here.)

Timeline for d3c96a1: