![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Lamprey globin [46518] (2 species) |
![]() | Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries) |
![]() | Domain d3lhbg_: 3lhb G: [15610] complexed with hem |
PDB Entry: 3lhb (more details), 2.7 Å
SCOPe Domain Sequences for d3lhbg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lhbg_ a.1.1.2 (G:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla aviadtvaagdagfeklmsmicillrsay
Timeline for d3lhbg_: