Lineage for d3lhbf_ (3lhb F:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632769Protein Lamprey globin [46518] (2 species)
  7. 632783Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 632790Domain d3lhbf_: 3lhb F: [15609]

Details for d3lhbf_

PDB Entry: 3lhb (more details), 2.7 Å

PDB Description: the 2.7 angstrom crystal structure of deoxygenated hemoglobin from the sea lamprey (petromyzon marinus)
PDB Compounds: (F:) protein (hemoglobin)

SCOP Domain Sequences for d3lhbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhbf_ a.1.1.2 (F:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d3lhbf_:

Click to download the PDB-style file with coordinates for d3lhbf_.
(The format of our PDB-style files is described here.)

Timeline for d3lhbf_: