Lineage for d3c91l1 (3c91 L:1-203)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1935363Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1936338Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries)
  8. 1936373Domain d3c91l1: 3c91 L:1-203 [156077]
    Other proteins in same PDB: d3c91a1, d3c91b1, d3c91c1, d3c91d1, d3c91e1, d3c91f1, d3c91g1, d3c91o1, d3c91p1, d3c91q1, d3c91r1, d3c91s1, d3c91t1, d3c91u1
    automatically matched to d1pma1_

Details for d3c91l1

PDB Entry: 3c91 (more details), 6.8 Å

PDB Description: thermoplasma acidophilum 20s proteasome with an open gate
PDB Compounds: (L:) Proteasome subunit beta

SCOPe Domain Sequences for d3c91l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c91l1 d.153.1.4 (L:1-203) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d3c91l1:

Click to download the PDB-style file with coordinates for d3c91l1.
(The format of our PDB-style files is described here.)

Timeline for d3c91l1: