| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species) contains an extension to the common fold at the N-terminus |
| Species Thermoplasma acidophilum [TaxId:2303] [56256] (3 PDB entries) |
| Domain d3c91b1: 3c91 B:13-233 [156067] Other proteins in same PDB: d3c9111, d3c9121, d3c91h1, d3c91i1, d3c91j1, d3c91k1, d3c91l1, d3c91m1, d3c91n1, d3c91v1, d3c91w1, d3c91x1, d3c91y1, d3c91z1 automatically matched to d1pmaa_ |
PDB Entry: 3c91 (more details), 6.8 Å
SCOPe Domain Sequences for d3c91b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c91b1 d.153.1.4 (B:13-233) Proteasome alpha subunit (non-catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
Timeline for d3c91b1:
View in 3DDomains from other chains: (mouse over for more information) d3c9111, d3c9121, d3c91a1, d3c91c1, d3c91d1, d3c91e1, d3c91f1, d3c91g1, d3c91h1, d3c91i1, d3c91j1, d3c91k1, d3c91l1, d3c91m1, d3c91n1, d3c91o1, d3c91p1, d3c91q1, d3c91r1, d3c91s1, d3c91t1, d3c91u1, d3c91v1, d3c91w1, d3c91x1, d3c91y1, d3c91z1 |