| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
| Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein) Pfam PF01503 |
| Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species) |
| Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [158761] (1 PDB entry) |
| Domain d3c90x_: 3c90 X: [156063] automated match to d1y6xa1 |
PDB Entry: 3c90 (more details), 1.79 Å
SCOPe Domain Sequences for d3c90x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c90x_ a.204.1.4 (X:) Phosphoribosyl-ATP pyrophosphatase HisE {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae
eisqllywtqvlmisrglslddvyrkl
Timeline for d3c90x_: