Lineage for d3c90c_ (3c90 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736411Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2736412Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2736467Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 2736468Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)
  7. 2736487Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [158761] (1 PDB entry)
  8. 2736490Domain d3c90c_: 3c90 C: [156062]
    automated match to d1y6xa1

Details for d3c90c_

PDB Entry: 3c90 (more details), 1.79 Å

PDB Description: The 1.25 A Resolution Structure of Phosphoribosyl-ATP Pyrophosphohydrolase from Mycobacterium tuberculosis, crystal form II
PDB Compounds: (C:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d3c90c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c90c_ a.204.1.4 (C:) Phosphoribosyl-ATP pyrophosphatase HisE {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae
eisqllywtqvlmisrglslddvyrkl

SCOPe Domain Coordinates for d3c90c_:

Click to download the PDB-style file with coordinates for d3c90c_.
(The format of our PDB-style files is described here.)

Timeline for d3c90c_: