Lineage for d3c8ya3 (3c8y A:127-209)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650266Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1650349Protein Fe-only hydrogenase, second domain [54885] (1 species)
  7. 1650350Species Clostridium pasteurianum [TaxId:1501] [54886] (4 PDB entries)
  8. 1650351Domain d3c8ya3: 3c8y A:127-209 [156059]
    Other proteins in same PDB: d3c8ya1, d3c8ya2
    automated match to d1feha3
    complexed with fes, gol, hcn, sf4

Details for d3c8ya3

PDB Entry: 3c8y (more details), 1.39 Å

PDB Description: 1.39 Angstrom crystal structure of Fe-only hydrogenase
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d3c8ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOPe Domain Coordinates for d3c8ya3:

Click to download the PDB-style file with coordinates for d3c8ya3.
(The format of our PDB-style files is described here.)

Timeline for d3c8ya3: