![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein Fe-only hydrogenase, second domain [54885] (1 species) |
![]() | Species Clostridium pasteurianum [TaxId:1501] [54886] (4 PDB entries) |
![]() | Domain d3c8ya3: 3c8y A:127-209 [156059] Other proteins in same PDB: d3c8ya1, d3c8ya2 automatically matched to d1c4aa3 complexed with fes, gol, hcn, sf4 |
PDB Entry: 3c8y (more details), 1.39 Å
SCOPe Domain Sequences for d3c8ya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd dtncllcgqciiacpvaalseks
Timeline for d3c8ya3: