Lineage for d3c8ya3 (3c8y A:127-209)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861105Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 861160Protein Fe-only hydrogenase, second domain [54885] (1 species)
  7. 861161Species Clostridium pasteurianum [TaxId:1501] [54886] (4 PDB entries)
  8. 861162Domain d3c8ya3: 3c8y A:127-209 [156059]
    Other proteins in same PDB: d3c8ya1, d3c8ya2
    automatically matched to d1c4aa3
    complexed with fes, gol, hcn, sf4

Details for d3c8ya3

PDB Entry: 3c8y (more details), 1.39 Å

PDB Description: 1.39 Angstrom crystal structure of Fe-only hydrogenase
PDB Compounds: (A:) Iron hydrogenase 1

SCOP Domain Sequences for d3c8ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOP Domain Coordinates for d3c8ya3:

Click to download the PDB-style file with coordinates for d3c8ya3.
(The format of our PDB-style files is described here.)

Timeline for d3c8ya3: