Lineage for d3c8ya1 (3c8y A:210-574)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147779Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 2147780Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 2147781Family c.96.1.1: Fe-only hydrogenase [53921] (3 protein domains)
  6. 2147786Protein Fe-only hydrogenase, catalytic domain [53922] (1 species)
    includes C-terminal region homologous to the smaller subunit of Desulfovidrio hydrogenase
  7. 2147787Species Clostridium pasteurianum [TaxId:1501] [53923] (4 PDB entries)
  8. 2147788Domain d3c8ya1: 3c8y A:210-574 [156057]
    Other proteins in same PDB: d3c8ya2, d3c8ya3
    automated match to d1feha1
    complexed with fes, gol, hcn, sf4

Details for d3c8ya1

PDB Entry: 3c8y (more details), 1.39 Å

PDB Description: 1.39 Angstrom crystal structure of Fe-only hydrogenase
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d3c8ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8ya1 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOPe Domain Coordinates for d3c8ya1:

Click to download the PDB-style file with coordinates for d3c8ya1.
(The format of our PDB-style files is described here.)

Timeline for d3c8ya1: