Lineage for d3c8ka2 (3c8k A:3-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938064Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2938082Domain d3c8ka2: 3c8k A:3-180 [156050]
    Other proteins in same PDB: d3c8ka1, d3c8kb_, d3c8kd_
    automatically matched to d1ddha2

Details for d3c8ka2

PDB Entry: 3c8k (more details), 2.9 Å

PDB Description: the crystal structure of ly49c bound to h-2kb
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d3c8ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8ka2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

SCOPe Domain Coordinates for d3c8ka2:

Click to download the PDB-style file with coordinates for d3c8ka2.
(The format of our PDB-style files is described here.)

Timeline for d3c8ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c8ka1