Lineage for d3c8ka1 (3c8k A:182-274)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1106920Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 1107014Domain d3c8ka1: 3c8k A:182-274 [156049]
    Other proteins in same PDB: d3c8ka2, d3c8kb_, d3c8kd_
    automatically matched to d1ddha1

Details for d3c8ka1

PDB Entry: 3c8k (more details), 2.9 Å

PDB Description: the crystal structure of ly49c bound to h-2kb
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d3c8ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8ka1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d3c8ka1:

Click to download the PDB-style file with coordinates for d3c8ka1.
(The format of our PDB-style files is described here.)

Timeline for d3c8ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c8ka2