SCOPe 2.04: Domain d3c8jc_: 3c8j C:

Lineage for d3c8jc_ (3c8j C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (17 PDB entries)

8. Domain d3c8jc_: 3c8j C: [156047]
   automated match to d1qo3c_

Details for d3c8jc_

PDB Entry: 3c8j, 2.6 Å

PDB Description: the crystal structure of natural killer cell receptor ly49c

PDB Compounds: (C:) Natural killer cell receptor Ly49C

SCOPe Domain Sequences for d3c8jc_:

Sequence; same for both SEQRES and ATOM records:

>d3c8jc_ d.169.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvipgnyw
iglsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyycicgkk
ldkfpd

Timeline for d3c8jc_:

• d3c8jc_ first appeared in SCOP 1.75, called d3c8jc1
  
• d3c8jc_ was called d3c8jc1 in SCOPe 2.03
  
• d3c8jc_ appears in SCOPe 2.05
  
• d3c8jc_ appears in the current release, SCOPe 2.08