Lineage for d3c8ja_ (3c8j A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559977Species Mouse (Mus musculus) [TaxId:10090] [187331] (27 PDB entries)
  8. 2560002Domain d3c8ja_: 3c8j A: [156045]
    automated match to d1qo3c_

Details for d3c8ja_

PDB Entry: 3c8j (more details), 2.6 Å

PDB Description: The crystal structure of natural killer cell receptor Ly49C
PDB Compounds: (A:) Natural killer cell receptor Ly49C

SCOPe Domain Sequences for d3c8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8ja_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tgrgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvipgny
wiglsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyycicgk
kldkfpd

SCOPe Domain Coordinates for d3c8ja_:

Click to download the PDB-style file with coordinates for d3c8ja_.
(The format of our PDB-style files is described here.)

Timeline for d3c8ja_: