Lineage for d3c8gc2 (3c8g C:1-168)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2021055Fold a.285: MtlR-like [158667] (1 superfamily)
    multihelical; 8-helical up-and-down bundle
  4. 2021056Superfamily a.285.1: MtlR-like [158668] (1 family) (S)
    automatically mapped to Pfam PF05068
  5. 2021057Family a.285.1.1: MtlR-like [158669] (2 proteins)
    Pfam PF05068; mannitol repressor
  6. 2021064Protein Putative transcriptional regulator YggD [158670] (1 species)
  7. 2021065Species Shigella flexneri [TaxId:623] [158671] (2 PDB entries)
    Uniprot Q83Q96 1-168! Uniprot Q83Q96 2-168! Uniprot Q83Q96 3-168
  8. 2021068Domain d3c8gc2: 3c8g C:1-168 [156035]
    Other proteins in same PDB: d3c8ga2, d3c8gc3
    automated match to d3c8ga1
    complexed with act

Details for d3c8gc2

PDB Entry: 3c8g (more details), 2.5 Å

PDB Description: crystal structure of a possible transciptional regulator yggd from shigella flexneri 2a str. 2457t
PDB Compounds: (C:) Putative transcriptional regulator

SCOPe Domain Sequences for d3c8gc2:

Sequence, based on SEQRES records: (download)

>d3c8gc2 a.285.1.1 (C:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfadfavwsearfsgmvktaltlavtttlkelt

Sequence, based on observed residues (ATOM records): (download)

>d3c8gc2 a.285.1.1 (C:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfadvwsearfsgmvktaltlavtttlkelt

SCOPe Domain Coordinates for d3c8gc2:

Click to download the PDB-style file with coordinates for d3c8gc2.
(The format of our PDB-style files is described here.)

Timeline for d3c8gc2: