![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.285: MtlR-like [158667] (1 superfamily) multihelical; 8-helical up-and-down bundle |
![]() | Superfamily a.285.1: MtlR-like [158668] (1 family) ![]() automatically mapped to Pfam PF05068 |
![]() | Family a.285.1.1: MtlR-like [158669] (2 proteins) Pfam PF05068; mannitol repressor |
![]() | Protein Putative transcriptional regulator YggD [158670] (1 species) |
![]() | Species Shigella flexneri [TaxId:623] [158671] (2 PDB entries) Uniprot Q83Q96 1-168! Uniprot Q83Q96 2-168! Uniprot Q83Q96 3-168 |
![]() | Domain d3c8gb1: 3c8g B:3-168 [156034] Other proteins in same PDB: d3c8ga2, d3c8gc3 complexed with act |
PDB Entry: 3c8g (more details), 2.5 Å
SCOPe Domain Sequences for d3c8gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c8gb1 a.285.1.1 (B:3-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]} tlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaqsg plddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvnsi trnatlydalkamkfadfavwsearfsgmvktaltlavtttlkelt
Timeline for d3c8gb1: