Lineage for d3c8ga1 (3c8g A:1-168)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781418Fold a.285: MtlR-like [158667] (1 superfamily)
    multihelical; 8-helical up-and-down bundle
  4. 781419Superfamily a.285.1: MtlR-like [158668] (1 family) (S)
  5. 781420Family a.285.1.1: MtlR-like [158669] (2 proteins)
    Pfam PF05068; mannitol repressor
  6. 781427Protein Putative transcriptional regulator YggD [158670] (1 species)
  7. 781428Species Shigella flexneri [TaxId:623] [158671] (1 PDB entry)
    Uniprot Q83Q96 1-168! Uniprot Q83Q96 2-168! Uniprot Q83Q96 3-168
  8. 781429Domain d3c8ga1: 3c8g A:1-168 [156033]
    complexed with act, mly

Details for d3c8ga1

PDB Entry: 3c8g (more details), 2.5 Å

PDB Description: crystal structure of a possible transciptional regulator yggd from shigella flexneri 2a str. 2457t
PDB Compounds: (A:) Putative transcriptional regulator

SCOP Domain Sequences for d3c8ga1:

Sequence, based on SEQRES records: (download)

>d3c8ga1 a.285.1.1 (A:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfadfavwsearfsgmvktaltlavtttlkelt

Sequence, based on observed residues (ATOM records): (download)

>d3c8ga1 a.285.1.1 (A:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfavwsearfsgmvktaltlavtttlkelt

SCOP Domain Coordinates for d3c8ga1:

Click to download the PDB-style file with coordinates for d3c8ga1.
(The format of our PDB-style files is described here.)

Timeline for d3c8ga1: