SCOPe 2.08: Domain d3c8ga1: 3c8g A:1-168

Lineage for d3c8ga1 (3c8g A:1-168)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.285: MtlR-like [158667] (1 superfamily)
   multihelical; 8-helical up-and-down bundle

4. Superfamily a.285.1: MtlR-like [158668] (1 family)
   automatically mapped to Pfam PF05068

5. Family a.285.1.1: MtlR-like [158669] (2 proteins)
   Pfam PF05068; mannitol repressor

6. Protein Putative transcriptional regulator YggD [158670] (1 species)

7. Species Shigella flexneri [TaxId:623] [158671] (2 PDB entries)
   Uniprot Q83Q96 1-168! Uniprot Q83Q96 2-168! Uniprot Q83Q96 3-168

8. Domain d3c8ga1: 3c8g A:1-168 [156033]
   Other proteins in same PDB: d3c8ga2, d3c8gc3
   complexed with act

Details for d3c8ga1

PDB Entry: 3c8g, 2.5 Å

PDB Description: crystal structure of a possible transciptional regulator yggd from shigella flexneri 2a str. 2457t

PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d3c8ga1:

Sequence, based on SEQRES records:

>d3c8ga1 a.285.1.1 (A:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfadfavwsearfsgmvktaltlavtttlkelt

Sequence, based on observed residues (ATOM records):

>d3c8ga1 a.285.1.1 (A:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfavwsearfsgmvktaltlavtttlkelt

Timeline for d3c8ga1:

• d3c8ga1 first appeared in SCOP 1.75
  
• d3c8ga1 appears in SCOPe 2.07