Lineage for d3c8dd2 (3c8d D:151-396)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869452Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1869467Protein Enterochelin esterase, catalytic domain [142699] (1 species)
  7. 1869468Species Shigella flexneri [TaxId:623] [142700] (4 PDB entries)
    Uniprot Q83SB9 151-397
  8. 1869472Domain d3c8dd2: 3c8d D:151-396 [156032]
    Other proteins in same PDB: d3c8da1, d3c8db1, d3c8dc1, d3c8dd1
    automated match to d2b20a2
    complexed with cit

Details for d3c8dd2

PDB Entry: 3c8d (more details), 1.8 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of 2,3-Di-hydroxy-N-benzoyl-glycine
PDB Compounds: (D:) enterochelin esterase

SCOPe Domain Sequences for d3c8dd2:

Sequence, based on SEQRES records: (download)

>d3c8dd2 c.69.1.2 (D:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagev
saeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglid
lwqplf

Sequence, based on observed residues (ATOM records): (download)

>d3c8dd2 c.69.1.2 (D:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwiftterplavlldgefwaqsmpvwpvlt
slthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdradrtv
vagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsaeglr
ivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlwqplf

SCOPe Domain Coordinates for d3c8dd2:

Click to download the PDB-style file with coordinates for d3c8dd2.
(The format of our PDB-style files is described here.)

Timeline for d3c8dd2: