SCOP 1.75: Domain d3c8db1: 3c8d B:7-150

Lineage for d3c8db1 (3c8d B:7-150)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
   PfamB PB013071

6. Protein Enterochelin esterase [141031] (2 species)

7. Species Shigella flexneri 2a str. 2457T [TaxId:198215] [158885] (3 PDB entries)

8. Domain d3c8db1: 3c8d B:7-150 [156027]
   Other proteins in same PDB: d3c8da2, d3c8db2, d3c8dc2, d3c8dd2
   automatically matched to d2b20a1
   complexed with cit

Details for d3c8db1

PDB Entry: 3c8d, 1.8 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of 2,3-Di-hydroxy-N-benzoyl-glycine

PDB Compounds: (B:) enterochelin esterase

SCOP Domain Sequences for d3c8db1:

Sequence, based on SEQRES records:

>d3c8db1 b.1.18.20 (B:7-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
gseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqpq
smqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiad
plnpqswkgglghavsalempqap

Sequence, based on observed residues (ATOM records):

>d3c8db1 b.1.18.20 (B:7-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
gseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdpqsmqria
gtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiadplnpqs
wklghavsalempqap

Timeline for d3c8db1:

• d3c8db1 is new in SCOP 1.75
  
• d3c8db1 appears in SCOPe 2.01
  
• d3c8db1 appears in the current release, SCOPe 2.08