SCOPe 2.07: Domain d3c87b1: 3c87 B:4-150

Lineage for d3c87b1 (3c87 B:4-150)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
   PfamB PB013071
   automatically mapped to Pfam PF11806

6. Protein Enterochelin esterase [141031] (1 species)

7. Species Shigella flexneri 2a str. 2457T [TaxId:198215] [141032] (4 PDB entries)
   Uniprot Q83SB9 3-150

8. Domain d3c87b1: 3c87 B:4-150 [156023]
   Other proteins in same PDB: d3c87a2, d3c87b2
   automated match to d2b20a1
   complexed with na, po4

Details for d3c87b1

PDB Entry: 3c87, 2.17 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of enterobactin

PDB Compounds: (B:) enterochelin esterase

SCOPe Domain Sequences for d3c87b1:

Sequence, based on SEQRES records:

>d3c87b1 b.1.18.20 (B:4-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
lkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqns
qpqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqa
iadplnpqswkgglghavsalempqap

Sequence, based on observed residues (ATOM records):

>d3c87b1 b.1.18.20 (B:4-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
lkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhsqpq
smqriagtdvwqwttqlnanwrgsycfipterddifsadrlelregwrkllpqaiadpln
pqswkgglghavsalempqap

Timeline for d3c87b1:

• d3c87b1 first appeared in SCOP 1.75
  
• d3c87b1 appears in SCOPe 2.06
  
• d3c87b1 appears in the current release, SCOPe 2.08