Lineage for d3c87b1 (3c87 B:4-150)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789658Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
    PfamB PB013071
  6. 789659Protein Enterochelin esterase [141031] (2 species)
  7. 789660Species Shigella flexneri 2a str. 2457T [TaxId:198215] [158885] (3 PDB entries)
  8. 789666Domain d3c87b1: 3c87 B:4-150 [156023]
    Other proteins in same PDB: d3c87a2, d3c87b2
    automatically matched to d2b20a1
    complexed with na, po4

Details for d3c87b1

PDB Entry: 3c87 (more details), 2.17 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of enterobactin
PDB Compounds: (B:) enterochelin esterase

SCOP Domain Sequences for d3c87b1:

Sequence, based on SEQRES records: (download)

>d3c87b1 b.1.18.20 (B:4-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
lkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqns
qpqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqa
iadplnpqswkgglghavsalempqap

Sequence, based on observed residues (ATOM records): (download)

>d3c87b1 b.1.18.20 (B:4-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
lkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhsqpq
smqriagtdvwqwttqlnanwrgsycfipterddifsadrlelregwrkllpqaiadpln
pqswkgglghavsalempqap

SCOP Domain Coordinates for d3c87b1:

Click to download the PDB-style file with coordinates for d3c87b1.
(The format of our PDB-style files is described here.)

Timeline for d3c87b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c87b2