Lineage for d3c87a2 (3c87 A:151-396)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134485Family c.69.1.2: Carboxylesterase [53487] (7 protein domains)
  6. 2134500Protein Enterochelin esterase, catalytic domain [142699] (1 species)
  7. 2134501Species Shigella flexneri [TaxId:623] [142700] (4 PDB entries)
    Uniprot Q83SB9 151-397
  8. 2134506Domain d3c87a2: 3c87 A:151-396 [156022]
    Other proteins in same PDB: d3c87a1, d3c87b1
    automated match to d2b20a2
    complexed with na, po4

Details for d3c87a2

PDB Entry: 3c87 (more details), 2.17 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of enterobactin
PDB Compounds: (A:) enterochelin esterase

SCOPe Domain Sequences for d3c87a2:

Sequence, based on SEQRES records: (download)

>d3c87a2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagev
saeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglid
lwqplf

Sequence, based on observed residues (ATOM records): (download)

>d3c87a2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrqqegvlleklkagevsa
eglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlw
qplf

SCOPe Domain Coordinates for d3c87a2:

Click to download the PDB-style file with coordinates for d3c87a2.
(The format of our PDB-style files is described here.)

Timeline for d3c87a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c87a1