Lineage for d3c7nb3 (3c7n B:189-384)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883725Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 2883726Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 2883802Domain d3c7nb3: 3c7n B:189-384 [156016]
    Other proteins in same PDB: d3c7nb1
    automatically matched to d1ngja2
    complexed with adp, bef, cl, mg, so4

Details for d3c7nb3

PDB Entry: 3c7n (more details), 3.12 Å

PDB Description: structure of the hsp110:hsc70 nucleotide exchange complex
PDB Compounds: (B:) Heat shock cognate

SCOPe Domain Sequences for d3c7nb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7nb3 c.55.1.1 (B:189-384) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaailsgdk

SCOPe Domain Coordinates for d3c7nb3:

Click to download the PDB-style file with coordinates for d3c7nb3.
(The format of our PDB-style files is described here.)

Timeline for d3c7nb3: