![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily) beta-sandwich: 8 strands in 2 sheets |
![]() | Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) ![]() |
![]() | Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins) |
![]() | Protein DnaK [100922] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [158953] (2 PDB entries) |
![]() | Domain d3c7nb1: 3c7n B:390-543 [156014] Other proteins in same PDB: d3c7nb2, d3c7nb3 automatically matched to d1ckra_ complexed with adp, bef, cl, mg, so4 |
PDB Entry: 3c7n (more details), 3.12 Å
SCOPe Domain Sequences for d3c7nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c7nb1 b.130.1.1 (B:390-543) DnaK {Cow (Bos taurus) [TaxId: 9913]} dlllldvtplslgietaggvmtvlikrnttiptkqtqtfttysdnqpgvliqvyegeram tkdnnllgkfeltgippaprgvpqievtfdidangilnvsavdkstgkenkititndkgr lskediermvqeaekykaedekqrdkvssknsle
Timeline for d3c7nb1: