Lineage for d3c6lg2 (3c6l G:1-82)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856736Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 856809Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)
  8. 856838Domain d3c6lg2: 3c6l G:1-82 [155986]
    Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc1, d3c6ld1, d3c6ld2, d3c6le1, d3c6le2, d3c6lg1, d3c6lh1, d3c6lh2
    automatically matched to d1k2da2
    complexed with ca

Details for d3c6lg2

PDB Entry: 3c6l (more details), 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
PDB Compounds: (G:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOP Domain Sequences for d3c6lg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c6lg2 d.19.1.1 (G:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp

SCOP Domain Coordinates for d3c6lg2:

Click to download the PDB-style file with coordinates for d3c6lg2.
(The format of our PDB-style files is described here.)

Timeline for d3c6lg2: