SCOPe 2.04: Domain d1f5oa_: 1f5o A:

Lineage for d1f5oa_ (1f5o A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Lamprey globin [46518] (2 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)

8. Domain d1f5oa_: 1f5o A: [15598]
   complexed with hem

Details for d1f5oa_

PDB Entry: 1f5o, 2.9 Å

PDB Description: 2.9 angstrom crystal structure of deoxygenated lamprey hemoglobin v in the space group p2(1)2(1)2(1)

PDB Compounds: (A:) hemoglobin v

SCOPe Domain Sequences for d1f5oa_:

Sequence; same for both SEQRES and ATOM records:

>d1f5oa_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

Timeline for d1f5oa_:

• d1f5oa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f5oa_ appears in SCOPe 2.03
  
• d1f5oa_ appears in SCOPe 2.05
  
• d1f5oa_ appears in the current release, SCOPe 2.08