SCOPe 2.06: Domain d3c6lc1: 3c6l C:83-182

Lineage for d3c6lc1 (3c6l C:83-182)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d3c6lc1: 3c6l C:83-182 [155979]
   Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le1, d3c6le2, d3c6lg2, d3c6lh1, d3c6lh2
   automatically matched to d1k2da1
   complexed with ca

Details for d3c6lc1

PDB Entry: 3c6l, 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20

PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d3c6lc1:

Sequence; same for both SEQRES and ATOM records:

>d3c6lc1 b.1.1.2 (C:83-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

Timeline for d3c6lc1:

• d3c6lc1 first appeared in SCOP 1.75
  
• d3c6lc1 appears in SCOPe 2.05
  
• d3c6lc1 appears in SCOPe 2.07
  
• d3c6lc1 appears in the current release, SCOPe 2.08