Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries) |
Domain d3c6la2: 3c6l A:113-188 [155978] Other proteins in same PDB: d3c6la1, d3c6lc1, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le1, d3c6lg1, d3c6lg2, d3c6lh1, d3c6lh2 automatically matched to d1lp9e2 complexed with ca |
PDB Entry: 3c6l (more details), 3.4 Å
SCOPe Domain Sequences for d3c6la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c6la2 b.1.1.2 (A:113-188) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng aiawsnqtsftcqdif
Timeline for d3c6la2: