![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries) |
![]() | Domain d3c6la2: 3c6l A:113-188 [155978] Other proteins in same PDB: d3c6la1, d3c6lc1, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le1, d3c6lg1, d3c6lg2, d3c6lh1, d3c6lh2 automatically matched to d1lp9e2 complexed with ca |
PDB Entry: 3c6l (more details), 3.4 Å
SCOP Domain Sequences for d3c6la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c6la2 b.1.1.2 (A:113-188) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng aiawsnqtsftcqdif
Timeline for d3c6la2: