SCOP 1.75: Domain d3c6la2: 3c6l A:113-188

Lineage for d3c6la2 (3c6l A:113-188)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)

8. Domain d3c6la2: 3c6l A:113-188 [155978]
   Other proteins in same PDB: d3c6la1, d3c6lc1, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le1, d3c6lg1, d3c6lg2, d3c6lh1, d3c6lh2
   automatically matched to d1lp9e2
   complexed with ca

Details for d3c6la2

PDB Entry: 3c6l, 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20

PDB Compounds: (A:) TCR 2W20 alpha chain

SCOP Domain Sequences for d3c6la2:

Sequence; same for both SEQRES and ATOM records:

>d3c6la2 b.1.1.2 (A:113-188) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdif

Timeline for d3c6la2:

• d3c6la2 is new in SCOP 1.75
  
• d3c6la2 appears in SCOPe 2.01
  
• d3c6la2 appears in the current release, SCOPe 2.08