SCOP 1.75: Domain d3c66b3: 3c66 B:352-530

Lineage for d3c66b3 (3c66 B:352-530)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families)

5. Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)

6. Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries)

8. Domain d3c66b3: 3c66 B:352-530 [155974]
   Other proteins in same PDB: d3c66a1, d3c66a2, d3c66b1, d3c66b2
   automatically matched to d1fa0b1
   complexed with gol, mes

Details for d3c66b3

PDB Entry: 3c66, 2.6 Å

PDB Description: yeast poly(a) polymerase in complex with fip1 residues 80-105

PDB Compounds: (B:) poly(a) polymerase

SCOP Domain Sequences for d3c66b3:

Sequence; same for both SEQRES and ATOM records:

>d3c66b3 d.58.16.1 (B:352-530) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps

Timeline for d3c66b3:

• d3c66b3 is new in SCOP 1.75
  
• d3c66b3 appears in SCOPe 2.01
  
• d3c66b3 appears in the current release, SCOPe 2.08