Lineage for d3c66b1 (3c66 B:202-351)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348647Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2348648Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2348649Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)
  6. 2348650Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)
  7. 2348651Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81628] (5 PDB entries)
  8. 2348659Domain d3c66b1: 3c66 B:202-351 [155972]
    Other proteins in same PDB: d3c66a2, d3c66a3, d3c66a4, d3c66b2, d3c66b3, d3c66b4
    automated match to d1fa0b3
    protein/RNA complex; complexed with gol, mes

Details for d3c66b1

PDB Entry: 3c66 (more details), 2.6 Å

PDB Description: yeast poly(a) polymerase in complex with fip1 residues 80-105
PDB Compounds: (B:) poly(a) polymerase

SCOPe Domain Sequences for d3c66b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c66b1 a.160.1.1 (B:202-351) Poly(A) polymerase, PAP, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pkpnvfrialraiklwaqrravyanifgfpggvawamlvaricqlypnacsavilnrffi
ilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvitpaypsmcathnitestk
kvilqefvrgvqitndifsnkkswanlfek

SCOPe Domain Coordinates for d3c66b1:

Click to download the PDB-style file with coordinates for d3c66b1.
(The format of our PDB-style files is described here.)

Timeline for d3c66b1: