Lineage for d3c66a3 (3c66 A:352-526)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560667Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2560668Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
    automatically mapped to Pfam PF04926
  6. 2560669Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 2560670Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries)
  8. 2560677Domain d3c66a3: 3c66 A:352-526 [155971]
    Other proteins in same PDB: d3c66a1, d3c66a2, d3c66a4, d3c66b1, d3c66b2, d3c66b4
    automated match to d1fa0b1
    protein/RNA complex; complexed with gol, mes

Details for d3c66a3

PDB Entry: 3c66 (more details), 2.6 Å

PDB Description: yeast poly(a) polymerase in complex with fip1 residues 80-105
PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d3c66a3:

Sequence, based on SEQRES records: (download)

>d3c66a3 d.58.16.1 (A:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene

Sequence, based on observed residues (ATOM records): (download)

>d3c66a3 d.58.16.1 (A:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
inkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene

SCOPe Domain Coordinates for d3c66a3:

Click to download the PDB-style file with coordinates for d3c66a3.
(The format of our PDB-style files is described here.)

Timeline for d3c66a3: