Lineage for d3c66a3 (3c66 A:352-530)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863067Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 863068Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
  6. 863069Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 863070Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries)
  8. 863073Domain d3c66a3: 3c66 A:352-530 [155971]
    Other proteins in same PDB: d3c66a1, d3c66a2, d3c66b1, d3c66b2
    automatically matched to d1fa0b1
    complexed with gol, mes

Details for d3c66a3

PDB Entry: 3c66 (more details), 2.6 Å

PDB Description: yeast poly(a) polymerase in complex with fip1 residues 80-105
PDB Compounds: (A:) poly(a) polymerase

SCOP Domain Sequences for d3c66a3:

Sequence, based on SEQRES records: (download)

>d3c66a3 d.58.16.1 (A:352-530) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps

Sequence, based on observed residues (ATOM records): (download)

>d3c66a3 d.58.16.1 (A:352-530) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
inkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps

SCOP Domain Coordinates for d3c66a3:

Click to download the PDB-style file with coordinates for d3c66a3.
(The format of our PDB-style files is described here.)

Timeline for d3c66a3: