![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) ![]() |
![]() | Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein) automatically mapped to Pfam PF04926 |
![]() | Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries) |
![]() | Domain d3c66a3: 3c66 A:352-526 [155971] Other proteins in same PDB: d3c66a1, d3c66a2, d3c66a4, d3c66b1, d3c66b2, d3c66b4 automated match to d1fa0b1 protein/RNA complex; complexed with gol, mes |
PDB Entry: 3c66 (more details), 2.6 Å
SCOPe Domain Sequences for d3c66a3:
Sequence, based on SEQRES records: (download)
>d3c66a3 d.58.16.1 (A:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene
>d3c66a3 d.58.16.1 (A:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn inkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene
Timeline for d3c66a3:
![]() Domains from other chains: (mouse over for more information) d3c66b1, d3c66b2, d3c66b3, d3c66b4 |