Lineage for d3c66a2 (3c66 A:3-201)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880450Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 880451Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 880629Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 880630Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 880631Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (5 PDB entries)
  8. 880634Domain d3c66a2: 3c66 A:3-201 [155970]
    Other proteins in same PDB: d3c66a1, d3c66a3, d3c66b1, d3c66b3
    automatically matched to d1fa0b4
    complexed with gol, mes

Details for d3c66a2

PDB Entry: 3c66 (more details), 2.6 Å

PDB Description: yeast poly(a) polymerase in complex with fip1 residues 80-105
PDB Compounds: (A:) poly(a) polymerase

SCOP Domain Sequences for d3c66a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c66a2 d.218.1.3 (A:3-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrf
vyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfds
llrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnlde
kdlralngtrvtdeilelv

SCOP Domain Coordinates for d3c66a2:

Click to download the PDB-style file with coordinates for d3c66a2.
(The format of our PDB-style files is described here.)

Timeline for d3c66a2: