Lineage for d2lhb__ (2lhb -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531489Protein Lamprey globin [46518] (2 species)
  7. 531503Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 531504Domain d2lhb__: 2lhb - [15597]
    complexed with hem

Details for d2lhb__

PDB Entry: 2lhb (more details), 2 Å

PDB Description: refinement of a molecular model for lamprey hemoglobin from petromyzon marinus

SCOP Domain Sequences for d2lhb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lhb__ a.1.1.2 (-) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d2lhb__:

Click to download the PDB-style file with coordinates for d2lhb__.
(The format of our PDB-style files is described here.)

Timeline for d2lhb__: