Class a: All alpha proteins [46456] (289 folds) |
Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) this domain follows the catalytic nucleotidyltransferase domain |
Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein) |
Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81628] (5 PDB entries) |
Domain d3c66a1: 3c66 A:202-351 [155969] Other proteins in same PDB: d3c66a2, d3c66a3, d3c66a4, d3c66b2, d3c66b3, d3c66b4 automated match to d1fa0b3 protein/RNA complex; complexed with gol, mes |
PDB Entry: 3c66 (more details), 2.6 Å
SCOPe Domain Sequences for d3c66a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c66a1 a.160.1.1 (A:202-351) Poly(A) polymerase, PAP, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pkpnvfrialraiklwaqrravyanifgfpggvawamlvaricqlypnacsavilnrffi ilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvitpaypsmcathnitestk kvilqefvrgvqitndifsnkkswanlfek
Timeline for d3c66a1:
View in 3D Domains from other chains: (mouse over for more information) d3c66b1, d3c66b2, d3c66b3, d3c66b4 |