SCOPe 2.04: Domain d3c60h1: 3c60 H:121-217

Lineage for d3c60h1 (3c60 H:121-217)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d3c60h1: 3c60 H:121-217 [155967]
   Other proteins in same PDB: d3c60a1, d3c60a2, d3c60b1, d3c60b2, d3c60c1, d3c60c2, d3c60d2, d3c60e1, d3c60e2, d3c60f1, d3c60f2, d3c60g1, d3c60g2, d3c60h2
   automated match to d1lnub1

Details for d3c60h1

PDB Entry: 3c60, 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62

PDB Compounds: (H:) 3K peptide, Linker, and H-2 class II histocompatibility antigen (A beta chain)

SCOPe Domain Sequences for d3c60h1:

Sequence; same for both SEQRES and ATOM records:

>d3c60h1 b.1.1.2 (H:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

Timeline for d3c60h1:

• d3c60h1 first appeared in SCOP 1.75
  
• d3c60h1 appears in SCOPe 2.03
  
• d3c60h1 appears in SCOPe 2.05
  
• d3c60h1 appears in the current release, SCOPe 2.08