Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d3c60d1: 3c60 D:121-217 [155963] Other proteins in same PDB: d3c60a1, d3c60a2, d3c60b1, d3c60b2, d3c60c1, d3c60c2, d3c60d2, d3c60e1, d3c60e2, d3c60f1, d3c60f2, d3c60g1, d3c60g2, d3c60h2 automated match to d1lnub1 |
PDB Entry: 3c60 (more details), 3.05 Å
SCOPe Domain Sequences for d3c60d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c60d1 b.1.1.2 (D:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw tfqvlvmlemtprrgevytchvehpslkspitvewka
Timeline for d3c60d1: