SCOPe 2.07: Domain d3c5zh1: 3c5z H:121-217

Lineage for d3c5zh1 (3c5z H:121-217)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d3c5zh1: 3c5z H:121-217 [155959]
   Other proteins in same PDB: d3c5za1, d3c5za2, d3c5zb1, d3c5zb2, d3c5zc1, d3c5zc2, d3c5zd2, d3c5ze1, d3c5ze2, d3c5zf1, d3c5zf2, d3c5zg1, d3c5zg2, d3c5zh2
   automated match to d1lnub1

Details for d3c5zh1

PDB Entry: 3c5z, 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506

PDB Compounds: (H:) 3K peptide, Linker, and H-2 class II histocompatibility antigen (A beta chain)

SCOPe Domain Sequences for d3c5zh1:

Sequence; same for both SEQRES and ATOM records:

>d3c5zh1 b.1.1.2 (H:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

Timeline for d3c5zh1:

• d3c5zh1 first appeared in SCOP 1.75
  
• d3c5zh1 appears in SCOPe 2.06
  
• d3c5zh1 appears in the current release, SCOPe 2.08