![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Mouse (Mus musculus), I-AB [TaxId:10090] [88815] (4 PDB entries) |
![]() | Domain d3c5zc2: 3c5z C:1-83 [155954] Other proteins in same PDB: d3c5za1, d3c5za2, d3c5zb1, d3c5zb2, d3c5zc1, d3c5zd1, d3c5zd2, d3c5ze1, d3c5ze2, d3c5zf1, d3c5zf2, d3c5zg1, d3c5zh1, d3c5zh2 automated match to d1lnua2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3c5z (more details), 2.55 Å
SCOPe Domain Sequences for d3c5zc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5zc2 d.19.1.1 (C:1-83) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]} ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg lqniavvkhnlgvltkrsnstpa
Timeline for d3c5zc2: