| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
| Domain d3c5zc1: 3c5z C:84-182 [155953] Other proteins in same PDB: d3c5za1, d3c5za2, d3c5zb1, d3c5zb2, d3c5zc2, d3c5zd1, d3c5zd2, d3c5ze1, d3c5ze2, d3c5zf1, d3c5zf2, d3c5zg2, d3c5zh1, d3c5zh2 automated match to d1lnua1 |
PDB Entry: 3c5z (more details), 2.55 Å
SCOPe Domain Sequences for d3c5zc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5zc1 b.1.1.2 (C:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrd
ysfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d3c5zc1: