Lineage for d1ch4b_ (1ch4 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530520Protein Chimeric hemoglobin beta-alpha [46516] (1 species)
  7. 530521Species Synthetic, based on Homo sapiens sequence [46517] (1 PDB entry)
  8. 530523Domain d1ch4b_: 1ch4 B: [15594]

Details for d1ch4b_

PDB Entry: 1ch4 (more details), 2.5 Å

PDB Description: module-substituted chimera hemoglobin beta-alpha (f133v)

SCOP Domain Sequences for d1ch4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ch4b_ a.1.1.2 (B:) Chimeric hemoglobin beta-alpha {Synthetic, based on Homo sapiens sequence}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
eftpavhasldkvlasvstvltskyr

SCOP Domain Coordinates for d1ch4b_:

Click to download the PDB-style file with coordinates for d1ch4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ch4b_: