SCOPe 2.08: Domain d3c5fa2: 3c5f A:329-385

Lineage for d3c5fa2 (3c5f A:329-385)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase lambda [101253] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)

8. Domain d3c5fa2: 3c5f A:329-385 [155938]
   Other proteins in same PDB: d3c5fa1, d3c5fa3, d3c5fb1, d3c5fb3
   automated match to d1xsna2
   protein/DNA complex; complexed with na; mutant

Details for d3c5fa2

PDB Entry: 3c5f, 2.25 Å

PDB Description: structure of a binary complex of the r517a pol lambda mutant

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3c5fa2:

Sequence; same for both SEQRES and ATOM records:

>d3c5fa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d3c5fa2:

• d3c5fa2 first appeared in SCOP 1.75
  
• d3c5fa2 appears in SCOPe 2.07