| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Chimeric hemoglobin beta-alpha [46516] (1 species) |
| Species Synthetic, based on Homo sapiens sequence [46517] (1 PDB entry) |
| Domain d1ch4a_: 1ch4 A: [15593] complexed with cmo, hem |
PDB Entry: 1ch4 (more details), 2.5 Å
SCOPe Domain Sequences for d1ch4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ch4a_ a.1.1.2 (A:) Chimeric hemoglobin beta-alpha {Synthetic, based on Homo sapiens sequence}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
eftpavhasldkvlasvstvltskyr
Timeline for d1ch4a_: